Product Browser

Last updated: 2015/8/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD79B (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00000974-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD79B full-length ORF (NP_000617.1) recombinant protein without tag.
  • Sequence:
  • MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 26
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 974
  • Gene Name:
  • CD79B
  • Gene Alias:
  • B29,IGB
  • Gene Description:
  • CD79b molecule, immunoglobulin-associated beta
  • Gene Summary:
  • The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • B-cell antigen receptor complex-associated protein beta chain,B-cell-specific glycoprotein B29,CD79B antigen,CD79b antigen (immunoglobulin-associated beta),Ig-beta,immunoglobulin-associated B29
  • RSS
  • YouTube
  • Linkedin
  • Facebook