CD48 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CD48 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD48 expression in human kidney.
Western Blot (Tissue lysate)
CD48 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD48 expression in mouse stomach.
Western Blot (Transfected lysate)
Western Blot analysis of CD48 expression in transfected 293T cell line by CD48 MaxPab rabbit polyclonal antibody.
Lane 1: CD48 transfected lysate(27.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CD48 protein.
Immunogen
CD48 (NP_001769.2, 1 a.a. ~ 243 a.a) full-length human protein.
Sequence
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (52); Rat (51)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CD48 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD48 expression in human kidney.Western Blot (Tissue lysate)
CD48 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD48 expression in mouse stomach.Western Blot (Transfected lysate)
Western Blot analysis of CD48 expression in transfected 293T cell line by CD48 MaxPab rabbit polyclonal antibody.
Lane 1: CD48 transfected lysate(27.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CD48
Entrez GeneID
962GeneBank Accession#
NM_001778Protein Accession#
NP_001769.2Gene Name
CD48
Gene Alias
BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
Gene Description
CD48 molecule
Omim ID
109530Gene Ontology
HyperlinkGene Summary
BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.[supplied by OMIM
Other Designations
CD48 antigen (B-cell membrane protein)|OTTHUMP00000025680|OTTHUMP00000060268
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com