CD40 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD40 full-length ORF (AAH12419.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
30.6
Interspecies Antigen Sequence
Mouse (61); Rat (59)
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — CD40
Entrez GeneID
958GeneBank Accession#
BC012419.1Protein Accession#
AAH12419.1Gene Name
CD40
Gene Alias
Bp50, CDW40, MGC9013, TNFRSF5, p50
Gene Description
CD40 molecule, TNF receptor superfamily member 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
B cell surface antigen CD40|B cell-associated molecule|CD40 antigen|CD40 antigen (TNF receptor superfamily member 5)|CD40 type II isoform|CD40L receptor|OTTHUMP00000031699|OTTHUMP00000031700|nerve growth factor receptor-related B-lymphocyte activation mol
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com