CD3Z monoclonal antibody (M01), clone 4A12-F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CD3Z monoclonal antibody (M01), clone 4A12-F6 Western Blot analysis of CD3Z expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CD247 expression in transfected 293T cell line by CD3Z monoclonal antibody (M01), clone 4A12-F6.
Lane 1: CD247 transfected lysate (Predicted MW: 18.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CD3Z on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5 ug/ml]
Immunoprecipitation
Immunoprecipitation of CD247 transfected lysate using anti-CD247 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD247 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD247 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CD3Z.
Immunogen
CD3Z (AAH25703, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (85)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CD3Z monoclonal antibody (M01), clone 4A12-F6 Western Blot analysis of CD3Z expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CD247 expression in transfected 293T cell line by CD3Z monoclonal antibody (M01), clone 4A12-F6.
Lane 1: CD247 transfected lysate (Predicted MW: 18.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CD3Z on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5 ug/ml]Immunoprecipitation
Immunoprecipitation of CD247 transfected lysate using anti-CD247 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD247 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD247 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CD247
Entrez GeneID
919GeneBank Accession#
BC025703Protein Accession#
AAH25703Gene Name
CD247
Gene Alias
CD3-ZETA, CD3H, CD3Q, CD3Z, T3Z, TCRZ
Gene Description
CD247 molecule
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD247 antigen, zeta subunit|CD3Z antigen, zeta polypeptide (TiT3 complex)|OTTHUMP00000032544|T-cell antigen receptor complex, zeta subunit of CD3|T-cell receptor T3 zeta chain|T-cell receptor zeta chain|T-cell surface glycoprotein CD3 zeta chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com