Product Browser

Last updated: 2015/8/30
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD3D MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00000915-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CD3D protein.
  • Immunogen:
  • CD3D (NP_000723, 1 a.a. ~ 171 a.a) full-length human protein.
  • Sequence:
  • MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD3D expression in transfected 293T cell line (H00000915-T01) by CD3D MaxPab polyclonal antibody.

    Lane 1: CD3D transfected lysate(18.81 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 915
  • Gene Name:
  • CD3D
  • Gene Alias:
  • CD3-DELTA,T3D
  • Gene Description:
  • CD3d molecule, delta (CD3-TCR complex)
  • Gene Summary:
  • The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq
  • Other Designations:
  • CD3D antigen, delta polypeptide,CD3d antigen, delta polypeptide (TiT3 complex),T-cell receptor T3 delta chain,T-cell surface glycoprotein CD3 delta chain
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook