RUNX3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RUNX3.
Immunogen
RUNX3 (NP_004341, 194 a.a. ~ 279 a.a) partial recombinant protein with GST tag.
Sequence
FPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.57 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RUNX3 polyclonal antibody (A01), Lot # 070226JCSa Western Blot analysis of RUNX3 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — RUNX3
Entrez GeneID
864GeneBank Accession#
NM_004350Protein Accession#
NP_004341Gene Name
RUNX3
Gene Alias
AML2, CBFA3, FLJ34510, MGC16070, PEBP2aC
Gene Description
runt-related transcription factor 3
Omim ID
600210Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000003370|OTTHUMP00000003371|PEA2 alpha C|PEBP2 alpha C|acute myeloid leukemia gene 2|core-binding factor, runt domain, alpha subunit 3|polyomavirus enhancer-binding protein 2 alpha C subunit|transcription factor AML2
-
Interactome
-
Disease
-
Publication Reference
-
RORβ Spinal Interneurons Gate Sensory Transmission during Locomotion to Secure a Fluid Walking Gait.
Koch SC, Del Barrio MG, Dalet A, Gatto G, Günther T, Zhang J, Seidler B, Saur D, Schüle R, Goulding M.
Neuron 2017 Dec; 96(6):1419.
Application:IF, IHC-Fr, Mouse, Mouse dorsal root ganglia, Mouse spinal cords.
-
Co-expression of Runx1 and Runx3 in mechanoreceptive neurons in dorsal root ganglion.
Yoshikawa M, Murakami Y, Senzaki K, Masuda T, Ozaki S, Ito Y, Shiga T.
Developmental Neurobiology 2013 Jun; 73(6):469.
Application:IHC-Fr, Mouse, Mouse embryos.
-
Brn3a/Pou4f1 regulates dorsal root ganglion sensory neuron specification and axonal projection into the spinal cord.
Zou M, Li S, Klein WH, Xiang M.
Developmental Biology 2012 Apr; 364(2):114.
Application:IF, Mouse, Dorsal root ganglia.
-
Runx3 is required for the specification of TrkC-expressing mechanoreceptive trigeminal ganglion neurons.
Senzaki K, Ozaki S, Yoshikawa M, Ito Y, Shiga T.
Molecular and Cellular Neurosciences 2010 Mar; 43(3):296.
Application:IF, IHC, Mouse, Mouse sagittal sections.
-
Expression of Sema3D in subsets of neurons in the developing dorsal root ganglia of the rat.
Takahashi K, Ishida M, Takahashi H.
Neuroscience Letters 2009 May; 455(1):17.
Application:IF, IHC-Fr, Rat, Rat dorsal root ganglia.
-
Dynamic regulation of the expression of neurotrophin receptors by Runx3.
Nakamura S, Senzaki K, Yoshikawa M, Nishimura M, Inoue K, Ito Y, Ozaki S, Shiga T.
Development 2008 Apr; 135(9):1703.
Application:IF, IHC-Fr, Mouse, Mouse embryo.
-
RORβ Spinal Interneurons Gate Sensory Transmission during Locomotion to Secure a Fluid Walking Gait.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com