Product Browser

Last updated: 2015/8/30
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAT polyclonal antibody (A01)

  • Catalog # : H00000847-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CAT.
  • Immunogen:
  • CAT (NP_001743, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000847-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAT polyclonal antibody (A01), Lot # ABNOVA060623QCS1. Western Blot analysis of CAT expression in Y-79.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAT polyclonal antibody (A01), Lot # 050921JC01 Western Blot analysis of CAT expression in A-431 ( Cat # L015V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 847
  • Gene Name:
  • CAT
  • Gene Alias:
  • MGC138422,MGC138424
  • Gene Description:
  • catalase
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook