MPPED2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MPPED2 protein.
Immunogen
MPPED2 (NP_001575.1, 1 a.a. ~ 294 a.a) full-length human protein.
Sequence
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MPPED2 expression in transfected 293T cell line (H00000744-T01) by MPPED2 MaxPab polyclonal antibody.
Lane 1: MPPED2 transfected lysate(33.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MPPED2
Entrez GeneID
744GeneBank Accession#
NM_001584Protein Accession#
NP_001575.1Gene Name
MPPED2
Gene Alias
239FB, C11orf8, D11S302E, FAM1B, Hs.46638, dJ1024C24.1, dJ873F21.1
Gene Description
metallophosphoesterase domain containing 2
Omim ID
600911Gene Ontology
HyperlinkGene Summary
This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
dJ1024C24.1 (C11ORF8 protein)|dJ873F21.1 (brain protein 239)
-
Interactome
-
Disease
-
Publication Reference
-
The Metallophosphoesterase-Domain-Containing Protein 2 (MPPED2) Gene Acts as Tumor Suppressor in Breast Cancer.
Pellecchia S, Sepe R, Federico A, Cuomo M, Credendino SC, Pisapia P, Bellevicine C, Nicolau-Neto P, Severo Ramundo M, Crescenzi E, De Vita G, Terracciano LM, Chiariotti L, Fusco A, Pallante P.
Cancers 2019 Jun; 11(6):E797.
Application:IHC, WB-Tr, Human, Human breast cancer, MDA-MB-468, MCF-7 cells.
-
The Long Non-Coding RNA RP5-1024C24.1 and Its Associated-Gene MPPED2 Are Down-Regulated in Human Thyroid Neoplasias and Act as Tumour Suppressors.
Sepe R, Pellecchia S, Serra P, D'Angelo D, Federico A, Raia M, Cortez Cardoso Penha R, Decaussin-Petrucci M, Vecchio LD, Fusco A, Pallante P.
Cancers 2018 May; 10(5):E146.
Application:IHC, WB-Tr, Human, Thyroid carcinomas, TPC-1-EV, TPC-1-MPPED2, FRO-EV, FRO-MPPED2 cells.
-
The Metallophosphoesterase-Domain-Containing Protein 2 (MPPED2) Gene Acts as Tumor Suppressor in Breast Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com