C1QC purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C1QC protein.
Immunogen
C1QC (NP_758957.2, 1 a.a. ~ 245 a.a) full-length human protein.
Sequence
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C1QC expression in transfected 293T cell line (H00000714-T01) by C1QC MaxPab polyclonal antibody.
Lane 1: C1QG transfected lysate(26.95 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C1QC
Entrez GeneID
714GeneBank Accession#
NM_172369Protein Accession#
NP_758957.2Gene Name
C1QC
Gene Alias
C1Q-C, C1QG, FLJ27103
Gene Description
complement component 1, q subcomponent, C chain
Omim ID
120575Gene Ontology
HyperlinkGene Summary
This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000002932|OTTHUMP00000002933|OTTHUMP00000037922|complement C1q subcomponent subunit C|complement component 1, q subcomponent, gamma polypeptide
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com