Product Browser

Last updated: 2015/4/12
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BNIP1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00000662-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human BNIP1 protein.
  • Immunogen:
  • BNIP1 (AAH10959, 1 a.a. ~ 228 a.a) full-length human protein.
  • Sequence:
  • MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • BNIP1 MaxPab polyclonal antibody. Western Blot analysis of BNIP1 expression in human pancreas.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BNIP1 expression in transfected 293T cell line (H00000662-T01) by BNIP1 MaxPab polyclonal antibody.

    Lane1:BNIP1 transfected lysate(25.19 KDa).
    Lane 2:Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 662
  • Gene Name:
  • BNIP1
  • Gene Alias:
  • NIP1,SEC20,TRG-8
  • Gene Description:
  • BCL2/adenovirus E1B 19kDa interacting protein 1
  • Gene Summary:
  • This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq
  • Other Designations:
  • BCL2/adenovirus E1B 19kD interacting protein 1,BCL2/adenovirus E1B 19kD-interacting protein 1,OTTHUMP00000161079
  • RSS
  • YouTube
  • Linkedin
  • Facebook