Product Browser

Last updated: 2015/8/30
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP7 monoclonal antibody (M11), clone 1H3

  • Catalog # : H00000655-M11
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant BMP7.
  • Immunogen:
  • BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 655
  • Gene Name:
  • BMP7
  • Gene Alias:
  • OP-1
  • Gene Description:
  • bone morphogenetic protein 7
  • Gene Summary:
  • The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031357,osteogenic protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook