BLK monoclonal antibody (M02), clone 7A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BLK.
Immunogen
BLK (AAH07371, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (64); Rat (66)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BLK monoclonal antibody (M02), clone 7A12. Western Blot analysis of BLK expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
BLK monoclonal antibody (M02), clone 7A12. Western Blot analysis of BLK expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.
Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLK is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BLK
-
Interactome
-
Disease
-
Publication Reference
-
BANK1 and BLK Act through Phospholipase C Gamma 2 in B-Cell Signaling.
Bernal-Quiros M, Wu YY, Alarcon-Riquelme ME, Castillejo-Lopez C.
PLoS One 2013 Mar; 8(3):e59842.
Application:WB, Human, Daudi B-cells.
-
Genetic and physical interaction of the B-cell systemic lupus erythematosus-associated genes BANK1 and BLK.
Castillejo-Lopez C, Delgado-Vega AM, Wojcik J, Kozyrev SV, Thavathiru E, Wu YY, Sanchez E, Pollmann D, Lopez-Egido JR, Fineschi S, Dominguez N, Lu R, James JA, Merrill JT, Kelly JA, Kaufman KM, Moser KL, Gilkeson G, Frostegard J, Pons-Estel BA, D'Alfonso S, Witte T, Callejas JL, Harley JB, Gaffney PM, Martin J, Guthridge JM, Alarcon-Riquelme ME.
Annals of the Rheumatic Diseases 2012 Jan; 71(1):136.
Application:IP-WB, WB-Ce, WB-Tr, Human, Daudi cells.
-
BANK1 and BLK Act through Phospholipase C Gamma 2 in B-Cell Signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com