Product Browser

Last updated: 2015/2/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APEX1 polyclonal antibody (A02)

  • Catalog # : H00000328-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant APEX1.
  • Immunogen:
  • APEX1 (NP_001632, 219 a.a. ~ 318 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000328-A02
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • APEX1 polyclonal antibody (A02), Lot # 060306JC01 Western Blot analysis of APEX1 expression in HL-60 ( Cat # L014V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 328
  • Gene Name:
  • APEX1
  • Gene Alias:
  • APE,APE-1,APE1,APEN,APEX,APX,HAP1,REF-1,REF1
  • Gene Description:
  • APEX nuclease (multifunctional DNA repair enzyme) 1
  • Gene Summary:
  • Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq
  • Other Designations:
  • AP endonuclease class I,AP lyase,APEX nuclease,DNA-(apurinic or apyrimidinic site) lyase,OTTHUMP00000163988,apurinic/apyrimidinic (abasic) endonuclease,apurinic/apyrimidinic exonuclease,deoxyribonuclease (apurinic or apyrimidinic),multifunctional DNA repa
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook