APCS monoclonal antibody (M07), clone 4E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant APCS.
Immunogen
APCS (NP_001630, 117 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (73)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APCS is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — APCS
Entrez GeneID
325GeneBank Accession#
NM_001639Protein Accession#
NP_001630Gene Name
APCS
Gene Alias
MGC88159, PTX2, SAP
Gene Description
amyloid P component, serum
Omim ID
104770Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq
Other Designations
9.5S alpha-1-glycoprotein|OTTHUMP00000024355|pentaxin-related|serum amyloid P component
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com