Product Browser

Last updated: 2014/4/14
  • Related Product Showcase
  • By Research Area

  • By Hot Target

  • By Application

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

ALPPL2 monoclonal antibody (M07), clone 2B3

  • Catalog # : H00000251-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ALPPL2.
  • Immunogen:
  • ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000251-M07
    Western Blot detection against Immunogen (35.64 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ALPPL2 monoclonal antibody (M07), clone 2B3 Western Blot analysis of ALPPL2 expression in A-431 ( Cat # L015V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ALPPL2 expression in transfected 293T cell line by ALPPL2 monoclonal antibody (M07), clone 2B3.

    Lane 1: ALPPL2 transfected lysate(57.5 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ALPPL2 transfected lysate using anti-ALPPL2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ALPPL2 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of ALPPL2 over-expressed 293 cell line, cotransfected with ALPPL2 Validated Chimera RNAi ( Cat # H00000251-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ALPPL2 monoclonal antibody (M07), clone 2B3 (Cat # H00000251-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Protocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 251
  • Gene Name:
  • ALPPL2
  • Gene Alias:
  • ALPG,ALPPL,GCAP
  • Gene Description:
  • alkaline phosphatase, placental-like 2
  • Gene Summary:
  • There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq
  • Other Designations:
  • Nagao isozyme,germ cell alkaline phosphatase,placental-like alkaline phosphatase,testicular and thymus alkaline phosphatase
  • RSS
  • YouTube
  • Linkedin
  • Facebook