ALPPL2 monoclonal antibody (M07), clone 2B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ALPPL2.
Immunogen
ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ALPPL2 monoclonal antibody (M07), clone 2B3 Western Blot analysis of ALPPL2 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ALPPL2 expression in transfected 293T cell line by ALPPL2 monoclonal antibody (M07), clone 2B3.
Lane 1: ALPPL2 transfected lysate(57.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of ALPPL2 transfected lysate using anti-ALPPL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ALPPL2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALPPL2 is 0.1 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ALPPL2 over-expressed 293 cell line, cotransfected with ALPPL2 Validated Chimera RNAi ( Cat # H00000251-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ALPPL2 monoclonal antibody (M07), clone 2B3 (Cat # H00000251-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ALPPL2
Entrez GeneID
251GeneBank Accession#
NM_031313Protein Accession#
NP_112603Gene Name
ALPPL2
Gene Alias
ALPG, ALPPL, GCAP
Gene Description
alkaline phosphatase, placental-like 2
Omim ID
171810Gene Ontology
HyperlinkGene Summary
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq
Other Designations
Nagao isozyme|germ cell alkaline phosphatase|placental-like alkaline phosphatase|testicular and thymus alkaline phosphatase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com