ACO1 monoclonal antibody (M01), clone 2C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACO1.
Immunogen
ACO1 (AAH18103, 780 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of ACO1 transfected lysate using anti-ACO1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACO1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ACO1
Entrez GeneID
48GeneBank Accession#
BC018103Protein Accession#
AAH18103Gene Name
ACO1
Gene Alias
ACONS, IREB1, IREBP, IREBP1, IRP1
Gene Description
aconitase 1, soluble
Omim ID
100880Gene Ontology
HyperlinkGene Summary
Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes. [provided by RefSeq
Other Designations
OTTHUMP00000021176|OTTHUMP00000021177|OTTHUMP00000045233|aconitase 1|aconitate hydratase|citrate hydro-lyase|ferritin repressor protein|iron regulatory protein 1|iron-responsive element binding protein 1
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
+ View More Disease
-
Publication Reference
-
IF/TA-related metabolic changes?Xproteome analysis of rat renal allografts.
Reuter S, Reiermann S, Worner R, Schroter R, Edemir B, Buck F, Henning S, Peter-Katalinic J, Vollenbroker B, Amann K, Pavenstadt H, Schlatter E, Gabriels G.
Nephrology, Dialysis, Transplantation: Official Publication of the European Dialysis 2010 Aug; 25(8):2492.
Application:WB-Ti, Rat, Rat renal allografts, Rat renal isografts.
-
IF/TA-related metabolic changes?Xproteome analysis of rat renal allografts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com