CHMP2B (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human CHMP2B full-length ORF ( AAH01553.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.17
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CHMP2B
Entrez GeneID
25978GeneBank Accession#
BC001553.1Protein Accession#
AAH01553.1Gene Name
CHMP2B
Gene Alias
CHMP2.5, DKFZp564O123, DMT1, VPS2-2, VPS2B
Gene Description
chromatin modifying protein 2B
Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq
Other Designations
charged multivesicular body protein 2b|vacuolar protein-sorting-associated protein 2-2
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
CHMP2B promotes CHMP7 mediated nuclear pore complex injury in sporadic ALS.
Olivia Keeley, Emma Mendoza, Druv Menon, Alyssa N Coyne.
Acta Neuropathologica Communications 2024 Dec; 12(1):199.
Application：IS, Human, iPSNs.
-
CHMP2B promotes CHMP7 mediated nuclear pore complex injury in sporadic ALS.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com