GST Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
Sequence
MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
25.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Publication Reference
-
Activation of AMP-activated protein kinase (AMPK) through inhibiting interaction with prohibitins.
Shuhei Kanagaki, Yusuke Tsutsui, Naoki Kobayashi, Takashi Komine, Minoru Ito, Yunike Akasaka, Michiaki Nagasawa, Tomohiro Ide, Naoki Omae, Kazuhisa Nakao, Makoto Rembutsu, Maki Iwago, Aki Yonezawa, Yusei Hosokawa, Tetsuya Hosooka, Wataru Ogawa, Koji Murakami.
iScience 2023 Feb; 26(4):106293.
Application：Pull-Down, Recombinant proteins.
-
A Novel Interaction Between Interferon-Inducible Protein p56 and Ribosomal Protein L15 in Gastric Cancer Cells.
Hsu YA, Lin HJ, Sheu JJ, Shieh FK, Chen SY, Lai CH, Tsai FJ, Wan L, Chen BH.
DNA and Cell Biology 2011 Sep; 30(9):671.
Application：PI, WB-Re, Recombinant protein.
-
An optimized assay for the enumeration of antigen-specific memory B cells in different compartments of the human body.
Cao Y, Gordic M, Kobold S, Lajmi N, Meyer S, Bartels K, Hildebrandt Y, Luetkens T, Ihloff AS, Kroger N, Bokemeyer C, Atanackovic D.
Journal of Immunological Methods 2010 Jun; 358(1-2):56.
Application：ELISA, ELISPOT, As a control.
-
Activation of AMP-activated protein kinase (AMPK) through inhibiting interaction with prohibitins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com