S1PR1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human S1PR1 full-length ORF (NP_001391.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.8
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — S1PR1
Entrez GeneID
1901GeneBank Accession#
NM_001400.3Protein Accession#
NP_001391.2Gene Name
S1PR1
Gene Alias
CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1
Gene Description
sphingosine-1-phosphate receptor 1
Omim ID
601974Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq
Other Designations
G protein-coupled sphingolipid receptor|OTTHUMP00000012525|endothelial differentiation, sphingolipid G-protein-coupled receptor, 1|sphingosine 1-phosphate receptor EDG1
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
A peptide immunoaffinity LC-MS/MS strategy for quantifying the GPCR protein, S1PR1 in human colon biopsies .
Hongwei Zhang, Eugene Ciccimaro, Jacob Zalaznick, Bogdan G Sleczka, Laurence Menard, Timothy V Olah, Petia Shipkova.
Bioanalysis 2020 Sep; 12(18):1311.
Application：Func, Quant, Human, Human colon samples, As a standard.
-
A peptide immunoaffinity LC-MS/MS strategy for quantifying the GPCR protein, S1PR1 in human colon biopsies .
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com