DVL1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (38.21 KDa) .
-
Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant DVL1.
Immunogen
DVL1 (NP_877580, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Sequence
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTG
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DVL1
Entrez GeneID
1855GeneBank Accession#
NM_182779Protein Accession#
NP_877580Gene Name
DVL1
Gene Alias
DVL, MGC54245
Gene Description
dishevelled, dsh homolog 1 (Drosophila)
Omim ID
601365Gene Ontology
HyperlinkGene Summary
DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development. [provided by RefSeq
Other Designations
OTTHUMP00000003104|dishevelled 1|dishevelled 1 (homologous to Drosophila dsh)
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
Turashvili G, Bouchal J, Baumforth K, Wei W, Dziechciarkova M, Ehrmann J, Klein J, Fridman E, Skarda J, Srovnal J, Hajduch M, Murray P, Kolar Z.
BMC Cancer 2007 Mar; 7:55.
Application：IHC-P, Human, Human lobular and ductal invasive breast carcinomas.
-
Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com