CBS monoclonal antibody (M06), clone 6A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBS is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBS on HeLa cell . [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant CBS.
Immunogen
CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (61); Rat (63)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBS is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBS on HeLa cell . [antibody concentration 20 ug/ml] -
Gene Info — CBS
Entrez GeneID
875GeneBank Accession#
NM_000071Protein Accession#
NP_000062Gene Name
CBS
Gene Alias
HIP4
Gene Description
cystathionine-beta-synthase
Omim ID
236200Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. [provided by RefSeq
Other Designations
OTTHUMP00000109416|OTTHUMP00000109418|beta-thionase|cystathionine beta-synthase|methylcysteine synthase|serine sulfhydrase
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap.
Jiang H, Hurt KJ, Breen K, Stabler SP, Allen RH, Orlicky DJ, Maclean KN.
Biology Open 2015 Aug; 4(9):1154.
Application：WB, Mouse, Liver.
-
Purification and characterization of cystathionine ?]-synthase bearing a cobalt protoporphyrin.
Majtan T, Freeman KM, Smith AT, Burstyn JN, Kraus JP.
Archives of Biochemistry and Biophysics 2011 Apr; 508(1):25.
Application：WB, E. coli, Recombinant protein.
-
Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com