CA3 monoclonal antibody (M02), clone 4A12-1A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CA3 monoclonal antibody (M02), clone 4A12-1A3 Western Blot analysis of CA3 expression in K-562 ( Cat # L009V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CA3 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (54.34 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CA3.
Immunogen
CA3 (AAH04897, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CA3 monoclonal antibody (M02), clone 4A12-1A3 Western Blot analysis of CA3 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CA3 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — CA3
Entrez GeneID
761GeneBank Accession#
BC004897Protein Accession#
AAH04897Gene Name
CA3
Gene Alias
CAIII, Car3
Gene Description
carbonic anhydrase III, muscle specific
Omim ID
114750Gene Ontology
HyperlinkGene Summary
Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. [provided by RefSeq
Other Designations
carbonic anhydrase III
-
Interactomes
-
Pathways
-
Publication Reference
-
Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.
McGinley C, Bishop DJ.
American Journal of Physiology. Regulatory, Integrative and Comparative Physiology 2017 May; 312(5):R702.
Application：WB, Human, Human muscle biopsies.
-
Influence of training intensity on adaptations in acid/base transport proteins, muscle buffer capacity, and repeated-sprint ability in active men.
McGinley C, Bishop DJ.
Journal of Applied Physiology 2016 Dec; 121(6):1290.
Application：WB, Human, Human muscle.
-
Expression of CAIII and Hsp70 Is Increased the Mucous Membrane of the Posterior Commissure in Laryngopharyngeal Reflux Disease.
Min HJ, Hong SC, Yang HS, Mun SK, Lee SY.
Yonsei Medical Journal 2016 Mar; 57(2):469.
Application：IHC, Human, Posterior Commissure Epithelium.
-
The human cardiac and skeletal muscle proteomes defined by transcriptomics and antibody-based profiling.
Lindskog C, Linne J, Fagerberg L, Hallstrom BM, Sundberg CJ, Lindholm M, Huss M, Kampf C, Choi H, Liem DA, Ping P, Varemo L, Mardinoglu A, Nielsen J, Larsson E, Ponten F, Uhlen M.
BMC Genomics 2015 Jun; 16:475.
Application：IHC, Human, Skeletal muscle.
-
Proteomic profiling of antisense-induced exon skipping reveals reversal of pathobiochemical abnormalities in dystrophic mdx diaphragm.
Doran P, Wilton SD, Fletcher S, Ohlendieck K.
Proteomics 2009 Feb; 9(3):671.
Application：Func, Mouse, Mouse skeletal muscle.
-
Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com