BAK1 (Human) Recombinant Protein (Q01)

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human BAK1 partial ORF ( AAH04431, 100 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BAK1
Entrez GeneID
578GeneBank Accession#
BC004431Protein Accession#
AAH04431Gene Name
BAK1
Gene Alias
BAK, BAK-LIKE, BCL2L7, CDN1, MGC117255, MGC3887
Gene Description
BCL2-antagonist/killer 1
Omim ID
600516Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq
Other Designations
BCL2-like 7 protein|Bcl-2 homologous antagonist/killer|OTTHUMP00000016211|OTTHUMP00000039620|apoptosis regulator BAK|pro-apoptotic protein BAK
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com