DMAP1 monoclonal antibody (M02), clone 1A5

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DMAP1.
Immunogen
DMAP1 (NP_061973, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5.
Lane 1: DMAP1 transfected lysate(53 KDa).
Lane 2: Non-transfected lysate.
ELISA
-
Gene Info — DMAP1
Entrez GeneID
55929GeneBank Accession#
NM_019100Protein Accession#
NP_061973Gene Name
DMAP1
Gene Alias
DKFZp686L09142, DNMAP1, DNMTAP1, EAF2, FLJ11543, KIAA1425, SWC4
Gene Description
DNA methyltransferase 1 associated protein 1
Omim ID
605077Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations
DNMT1 associated protein 1|OTTHUMP00000008845|OTTHUMP00000008846|OTTHUMP00000008847
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com