FAIM3 monoclonal antibody (M01), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FAIM3 monoclonal antibody (M01), clone 1E4 Western Blot analysis of FAIM3 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.
Lane 1: FAIM3 transfected lysate(43.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant FAIM3.
Immunogen
FAIM3 (AAH06401, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (57); Rat (54)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FAIM3 monoclonal antibody (M01), clone 1E4 Western Blot analysis of FAIM3 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.
Lane 1: FAIM3 transfected lysate(43.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — FAIM3
-
Interactomes
-
Publication Reference
-
Glycan-independent binding and internalization of human IgM to FCMR, its cognate cellular receptor.
Lloyd KA, Wang J, Urban BC, Czajkowsky DM, Pleass RJ.
Scientific Reports 2017 Feb; 7:42989.
Application：Flow Cyt, Mouse, Mouse BW5147 T cell line.
-
Toso, a functional IgM receptor, is regulated by IL-2 in T and NK cells.
Murakami Y, Narayanan S, Su S, Childs R, Krzewski K, Borrego F, Weck J, Coligan JE.
Journal of Immunology 2012 Jul; 189(2):587.
Application：Flow Cyt, Human, NK cells.
-
Enhanced levels of both membrane-bound and soluble forms of IgM Fc receptor in patients with chronic lymphocytic leukemia.
Li FJ, Kubagawa Y, McCollum MK, Wilson L, Motohashi T, Bertoli LF, Barton JC, Barnes S, Davis RS, Kubagawa H.
Blood 2011 Nov; 118(18):4902.
Application：Flow Cyt, Human, PBMCs.
-
SAGE analysis demonstrates increased expression of TOSO contributing to Fas mediated resistance in CLL.
Proto-Siqueira R, Panepucci RA, Careta FP, Lee A, Clear A, Morris K, Owen C, Rizzatti EG, Silva-Jr WA, Falcao RP, Zago MA, Gribben JG.
Blood 2008 Apr; 112(2):394.
Application：Flow Cyt, IHC, Human, Human chronic lymphocytic leukemia.
-
Glycan-independent binding and internalization of human IgM to FCMR, its cognate cellular receptor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com