UNC119 monoclonal antibody (M01), clone 2F9-2A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody (M01), clone 2F9-2A9.
Lane 1: UNC119 transfected lysate(27 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of UNC119 transfected lysate using anti-UNC119 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UNC119 purified MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (52.14 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant UNC119.
Immunogen
UNC119 (AAH27176.1, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.14 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody (M01), clone 2F9-2A9.
Lane 1: UNC119 transfected lysate(27 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of UNC119 transfected lysate using anti-UNC119 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UNC119 purified MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — UNC119
Entrez GeneID
9094GeneBank Accession#
BC027176Protein Accession#
AAH27176.1Gene Name
UNC119
Gene Alias
HRG4
Gene Description
unc-119 homolog (C. elegans)
Omim ID
604011Gene Ontology
HyperlinkGene Summary
This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
retinal protein 4|unc119 (C.elegans) homolog|unc119 homolog
-
Interactome
-
Disease
-
Publication Reference
-
The RAS-interacting Chaperone UNC119 Drives the RASSF6-MDM2-p53 Axis and Antagonizes RAS-mediated Malignant Transformation.
Takanobu Shimizu, Takeshi Nakamura, Hironori Inaba, Hiroaki Iwasa, Junichi Maruyama, Kyoko Arimoto-Matsuzaki, Takao Nakata, Hiroshi Nishina, Yutaka Hata.
The Journal of Biological Chemistry 2020 Aug; 295(32):11214.
Application：IP, Human, SW480 cells.
-
The RAS-interacting Chaperone UNC119 Drives the RASSF6-MDM2-p53 Axis and Antagonizes RAS-mediated Malignant Transformation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com