PTK2 monoclonal antibody (M01), clone 2C3

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PTK2.
Immunogen
PTK2 (AAH28733, 355 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.59 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PTK2 monoclonal antibody (M01), clone 2C3 Western Blot analysis of PTK2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PTK2 transfected lysate using anti-PTK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTK2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTK2 is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STAT1 and PTK2. HeLa cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-PTK2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PTK2
Entrez GeneID
5747GeneBank Accession#
BC028733Protein Accession#
AAH28733Gene Name
PTK2
Gene Alias
FADK, FAK, FAK1, pp125FAK
Gene Description
PTK2 protein tyrosine kinase 2
Omim ID
600758Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. At least four transcript variants encoding four different isoforms have been found for this gene, but the full-length natures of only two of them have been determined. [provided by RefSeq
Other Designations
focal adhesion kinase 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
MicroRNA-101-5p Suppresses the Expression of the Ras-Related Protein RAP1A.
Shibayama Y, Kubo Y, Nakagawa T, Iseki K.
Biological & Pharmaceutical Bulletin 2019 May; 42(8):1332.
Application:WB-Tr, Human, HeLa cells.
-
JNK Pathway-associated Phosphatase Dephosphorylates Focal Adhesion Kinase and Suppresses Cell Migration.
Li JP, Fu YN, Chen YR, Tan TH.
The Journal of Biological Chemistry 2010 Feb; 285(8):5472.
Application:WB, IP, Human, H1299 cells.
-
MicroRNA-101-5p Suppresses the Expression of the Ras-Related Protein RAP1A.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com