IRAK2 monoclonal antibody (M04), clone 1A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
IRAK2 monoclonal antibody (M04), clone 1A6 Western Blot analysis of IRAK2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
IRAK2 monoclonal antibody (M04), clone 1A6. Western Blot analysis of IRAK2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
IRAK2 monoclonal antibody (M04), clone 1A6. Western Blot analysis of IRAK2 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant IRAK2.
Immunogen
IRAK2 (NP_001561, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (52); Rat (59)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IRAK2 monoclonal antibody (M04), clone 1A6 Western Blot analysis of IRAK2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
IRAK2 monoclonal antibody (M04), clone 1A6. Western Blot analysis of IRAK2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
IRAK2 monoclonal antibody (M04), clone 1A6. Western Blot analysis of IRAK2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — IRAK2
Entrez GeneID
3656GeneBank Accession#
NM_001570Protein Accession#
NP_001561Gene Name
IRAK2
Gene Alias
IRAK-2, MGC150550
Gene Description
interleukin-1 receptor-associated kinase 2
Omim ID
603304Gene Ontology
HyperlinkGene Summary
IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. [provided by RefSeq
Other Designations
interleukin-1 receptor associated kinase-2
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com