

GYPC (Human) Recombinant Protein

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human GYPC full-length ORF (NP_002092.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
13.8
Interspecies Antigen Sequence
Mouse (84); Rat (70)
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — GYPC
Entrez GeneID
2995GeneBank Accession#
NM_002101.3Protein Accession#
NP_002092.1Gene Name
GYPC
Gene Alias
CD236, CD236R, GE, GPC, GYPD, MGC117309, MGC126191, MGC126192
Gene Description
glycophorin C (Gerbich blood group)
Gene Ontology
HyperlinkGene Summary
Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq
Other Designations
glycophorin C
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com