FOXC2 monoclonal antibody (M04), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in 293.
Western Blot (Cell lysate)
FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in NIH/3T3.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXC2 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FOXC2.
Immunogen
FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in 293.Western Blot (Cell lysate)
FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in NIH/3T3.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXC2 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — FOXC2
Entrez GeneID
2303GeneBank Accession#
NM_005251Protein Accession#
NP_005242Gene Name
FOXC2
Gene Alias
FKHL14, LD, MFH-1, MFH1
Gene Description
forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Gene Ontology
HyperlinkGene Summary
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq
Other Designations
MFH-1,mesenchyme forkhead 1|forkhead box C2|forkhead, Drosophila, homolog-like 14|forkhead-like 14
-
Interactome
-
Disease
-
Publication Reference
-
Novel FOXC2 Mutation in Hereditary Distichiasis Impairs DNA-Binding Activity and Transcriptional Activation.
Zhang L, He J, Han B, Lu L, Fan J, Zhang H, Ge S, Zhou Y, Jia R, Fan X.
International Journal of Biological Sciences 2016 Aug; 12(9):1114.
Application：EMSA, Human, 293T cells.
-
Novel FOXC2 Mutation in Hereditary Distichiasis Impairs DNA-Binding Activity and Transcriptional Activation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com