ATP6AP1 monoclonal antibody (M01), clone 3A2

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATP6AP1.
Immunogen
ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP6AP1 monoclonal antibody (M01), clone 3A2 Western Blot analysis of ATP6AP1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ATP6AP1 monoclonal antibody (M01), clone 3A2. Western Blot analysis of ATP6AP1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M01), clone 3A2.
Lane 1: ATP6AP1 transfected lysate(52 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP6AP1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ATP6AP1
Entrez GeneID
537GeneBank Accession#
NM_001183Protein Accession#
NP_001174Gene Name
ATP6AP1
Gene Alias
16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3
Gene Description
ATPase, H+ transporting, lysosomal accessory protein 1
Omim ID
300197Gene Ontology
HyperlinkGene Summary
This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump), subunit 1|ATPase, H+ transporting, lysosomal interacting protein 1|H-ATPase subunit|OTTHUMP00000032115|V-ATPase S1 accessory protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Frequent mutations of genes encoding vacuolar H+ -ATPase components in granular cell tumors.
Sekimizu M, Yoshida A, Mitani S, Asano N, Hirata M, Kubo T, Yamazaki F, Sakamoto H, Kato M, Makise N, Mori T, Yamazaki N, Sekine S, Oda I, Watanabe SI, Hiraga H, Yonemoto T, Kawamoto T, Naka N, Funauchi Y, Nishida Y, Honoki K, Kawano H, Tsuchiya H, Kunisada T, Matsuda K, Inagaki K, Kawai A, Ichikawa H.
Genes, Chromosomes & Cancer 2019 Jun; 58(6):373.
Application:WB, Human, Granular cell tumors, SYO-1 cells.
-
Vacuolar H+-ATPase subunit Voa1 and Voa2 cooperatively regulate secretory vesicle acidification, transmitter uptake and storage.
Saw NM, Kang SY, Parsaud L, Han GA, Jiang T, Grzegorczyk K, Surkont M, Sun-Wada GH, Wada Y, Li L, Sugita S.
Molecular Biology of the Cell 2011 Sep; 22(18):3394.
Application:WB, Rat, PC-12 cells.
-
Frequent mutations of genes encoding vacuolar H+ -ATPase components in granular cell tumors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com