C21orf33 monoclonal antibody (M01), clone 1F5

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant C21orf33.
Immunogen
C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
C21orf33 monoclonal antibody (M01), clone 1F5 Western Blot analysis of C21orf33 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of C21orf33 expression in transfected 293T cell line by C21orf33 monoclonal antibody (M01), clone 1F5.
Lane 1: C21orf33 transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to C21orf33 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — C21orf33
Entrez GeneID
8209GeneBank Accession#
NM_004649Protein Accession#
NP_004640Gene Name
C21orf33
Gene Alias
D21S2048E, ES1, GT335, HES1, KNP-I, KNPH, KNPI
Gene Description
chromosome 21 open reading frame 33
Omim ID
601659Gene Ontology
HyperlinkGene Summary
homolog to E.coli and zebrafish ES1 protein
Other Designations
Keio novel protein I|es1 protein|human HES1 protein, homolog to E.coli and zebrafish ES1 protein
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com