ACTN4 monoclonal antibody (M01), clone 4D10

Catalog # H00000081-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ACTN4 monoclonal antibody (M01), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in MCF-7 ( Cat # L046V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in NIH/3T3 ( Cat # L018V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01), clone 4D10.

Lane 1: ACTN4 transfected lysate(104.9 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. [antibody concentration 3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged ACTN4 is approximately 0.1ng/ml as a capture antibody.

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20 ug/ml]

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specifications

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant ACTN4.MAB,monoclonal Ab,monoclonal antibody

    Immunogen

    ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (99); Rat (98)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    ACTN4 monoclonal antibody (M01), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Cell lysate)

    ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in MCF-7 ( Cat # L046V1 ).

    Western Blot (Cell lysate)

    ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in NIH/3T3 ( Cat # L018V1 ).

    Western Blot (Cell lysate)

    ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01), clone 4D10.

    Lane 1: ACTN4 transfected lysate(104.9 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. [antibody concentration 3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged ACTN4 is approximately 0.1ng/ml as a capture antibody.

    ELISA

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20 ug/ml]
  • Gene Info — ACTN4

    Entrez GeneID

    81

    GeneBank Accession#

    NM_004924

    Protein Accession#

    NP_004915

    Gene Name

    ACTN4

    Gene Alias

    ACTININ-4, DKFZp686K23158, FSGS, FSGS1

    Gene Description

    actinin, alpha 4

    Omim ID

    603278 604638

    Gene Ontology

    Hyperlink

    Gene Summary

    Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. [provided by RefSeq

    Other Designations

    actinin alpha4 isoform

  • Interactomes
  • Pathways
  • Diseases
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All