ACTN4 monoclonal antibody (M01), clone 4D10

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACTN4.
Immunogen
ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
ACTN4 monoclonal antibody (M01), clone 4D10. Western Blot analysis of ACTN4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01), clone 4D10.
Lane 1: ACTN4 transfected lysate(104.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACTN4 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — ACTN4
Entrez GeneID
81GeneBank Accession#
NM_004924Protein Accession#
NP_004915Gene Name
ACTN4
Gene Alias
ACTININ-4, DKFZp686K23158, FSGS, FSGS1
Gene Description
actinin, alpha 4
Gene Ontology
HyperlinkGene Summary
Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. [provided by RefSeq
Other Designations
actinin alpha4 isoform
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Actinin-4 splice variant - a complementary diagnostic and prognostic marker of pancreatic neuroendocrine neoplasms.
Xu X, Honda K, Miura N, Hori S, Le Blanc S, Bergmann F, Gaida MM, Volkmar M, Schimmack S, Hackert T, Strobel O, Felix K.
Journal of Cancer 2020 Feb; 11(8):2318.
Application:IHC-P, Human, Human pancreatic neuroendocrine neoplasms.
-
The actin cytoskeleton is important for rotavirus internalization and RNA genome replication.
Trejo-Cerro O, Aguilar-Hernández N, Silva-Ayala D, López S, Arias CF.
Virus Research 2019 Jan; 263:27.
Application:WB-Tr, Monkey, MA104 cells.
-
Actinin-4 protein overexpression as a predictive biomarker in adjuvant chemotherapy for resected lung adenocarcinoma.
Shiraishi H, Fujiwara Y, Kakuya T, Tsuta K, Motoi N, Miura N, Watabe Y, Watanabe SI, Noro R, Nagashima K, Huang W, Yamada T, Asamura H, Ohe Y, Honda K.
Biomarkers in Medicine 2017 Jun; [Epub].
Application:IHC-P, Human, Human lung adenocarcinoma.
-
Expression of Nephrin, Podocin, alpha-Actinin-4 and alpha-3-Integrin in Canine Renal Glomeruli.
R Kobayashi, J Kamiie, K Yasuno, K Ogihara, K Shirota.
Journal of Comparative Pathology 2011 Aug; 145(2-3):220.
Application:IF, IHC-Fr, WB-Ti, Dog, Dog kidney.
-
RNAi-mediated down-regulation of alpha-actinin-4 decreases invasion potential in oral squamous cell carcinoma.
Yamada S, Yanamoto S, Yoshida H, Yoshitomi I, Kawasaki G, Mizuno A, Nemoto TK.
International Journal of Oral and Maxillofacial Surgery 2009 Nov; 39(1):61.
Application:IHC-P, WB-Ce, WB-Tr, Human, Ca9-22, HEKa, HSC-2, HSC3, HSC-4, OSC20, SAS, SCC25 cells, Human oral squamous cell carcinomas.
-
Actinin-4 splice variant - a complementary diagnostic and prognostic marker of pancreatic neuroendocrine neoplasms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com