ANGPTL4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ANGPTL4 full-length ORF ( AAH23647.1, 26 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
67.65
Interspecies Antigen Sequence
Mouse (75); Rat (76)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ANGPTL4
Entrez GeneID
51129GeneBank Accession#
BC023647Protein Accession#
AAH23647.1Gene Name
ANGPTL4
Gene Alias
ANGPTL2, ARP4, FIAF, HFARP, NL2, PGAR, pp1158
Gene Description
angiopoietin-like 4
Omim ID
605910Gene Ontology
HyperlinkGene Summary
This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. This gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. The encoded protein is a serum hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity and also acts as an apoptosis survival factor for vascular endothelial cells. The encoded protein may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq
Other Designations
PPARG angiopoietin related protein|angiopoietin-like 4 protein|angiopoietin-related protein 4|fasting-induced adipose factor|hepatic angiopoietin-related protein|hepatic fibrinogen/angiopoietin-related protein|peroxisome proliferator-activated receptor (P
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
cis-9, trans-11 conjugated linoleic acid stimulates expression of angiopoietin like-4 in the placental extravillous trophoblast cells.
Basak S, Duttaroy AK.
Biochimica Et Biophysica Acta 2013 Jan; 1831(4):834.
Application:Func, Human, HTR8/SVneo cell.
-
Enhanced Angiogenesis in Obesity and in Response to PPAR{gamma} Activators Through Adipocyte VEGF and ANGPTL4 Production.
Gealekman O, Burkart A, Chouinard M, Nicoloro S, Straubhaar J, Corvera S.
American Journal of Physiology. Endocrinology and Metabolism 2008 Aug; 295(5):E1056.
Application:Func, Human, HUVEC.
-
cis-9, trans-11 conjugated linoleic acid stimulates expression of angiopoietin like-4 in the placental extravillous trophoblast cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com