TARBP2 monoclonal antibody (M03), clone 1D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TARBP2 expression in transfected 293T cell line by TARBP2 monoclonal antibody (M03), clone 1D9.
Lane 1: TARBP2 transfected lysate (Predicted MW: 39 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TARBP2 transfected lysate using anti-TARBP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TARBP2 purified MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TARBP2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TARBP2.
Immunogen
TARBP2 (NP_599150, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TARBP2 expression in transfected 293T cell line by TARBP2 monoclonal antibody (M03), clone 1D9.
Lane 1: TARBP2 transfected lysate (Predicted MW: 39 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TARBP2 transfected lysate using anti-TARBP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TARBP2 purified MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TARBP2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — TARBP2
Entrez GeneID
6895GeneBank Accession#
NM_134323Protein Accession#
NP_599150Gene Name
TARBP2
Gene Alias
LOQS, TRBP, TRBP1, TRBP2
Gene Description
TAR (HIV-1) RNA binding protein 2
Omim ID
605053Gene Ontology
HyperlinkGene Summary
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene. [provided by RefSeq
Other Designations
TAR (HIV) RNA binding protein 2|TAR (HIV) RNA-binding protein 2|TAR (HIV) RNA-binding protein TRBP1|TAR RNA binding protein 2|TAR RNA-binding protein 2|trans-activation responsive RNA-binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com