RBMS1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RBMS1 partial ORF ( NP_058520.1, 291 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
YIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATSAMQGAYLPQYAHMQTTAVPV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RBMS1
Entrez GeneID
5937GeneBank Accession#
NM_016836Protein Accession#
NP_058520.1Gene Name
RBMS1
Gene Alias
MGC15146, MGC3331, MSSP, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Gene Description
RNA binding motif, single stranded interacting protein 1
Omim ID
602310Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq
Other Designations
c-myc gene single strand binding protein 2|suppressor of cdc 2 (cdc13) with RNA binding motif 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com