SMAD3 monoclonal antibody (M05), clone 4D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMAD3.
Immunogen
SMAD3 (NP_005893, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M05), clone 4D5. Western Blot analysis of SMAD3 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
SMAD3 monoclonal antibody (M05), clone 4D5 Western Blot analysis of SMAD3 expression in PC-12 ( Cat # L012V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMAD3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — SMAD3
Entrez GeneID
4088GeneBank Accession#
NM_005902Protein Accession#
NP_005893Gene Name
SMAD3
Gene Alias
DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396
Gene Description
SMAD family member 3
Omim ID
603109Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
Other Designations
MAD, mothers against decapentaplegic homolog 3|SMA- and MAD-related protein 3|SMAD, mothers against DPP homolog 3|mad homolog JV15-2|mad protein homolog|mothers against decapentaplegic homolog 3
-
Interactome
-
Pathway
-
Disease
- Alzheimer disease
- Anemia
- Asthma
- Bacteremia
- Breast cancer
- Breast Neoplasms
- Cleft Lip
- Cleft Palate
- Coronary Artery Disease
+ View More Disease
-
Publication Reference
-
Dysregulation of the TGFBI gene is involved in the oncogenic activity of the nonsense mutation of hepatitis B virus surface gene sW182*.
Jiang SS, Huang SF, Huang MS, Chen YT, Jhong HJ, Chang IC, Chen YT, Chang JW, Chen WL, Lee WC, Chen MF, Yeh CT, Matsuura I.
Biochimica et Biophysica Acta 2014 Jul; 1842(7):1080.
Application:WB, Mouse, NIH3T3 cells.
-
Activin A Regulates Porcine Follicle-Stimulating Hormone {beta}-Subunit Transcription via Cooperative Actions of SMADs and FOXL2.
Lamba P, Wang Y, Tran S, Ouspenskaia T, Libasci V, Hebert TE, Miller GJ, Bernard DJ.
Endocrinology 2010 Nov; 151(11):5456.
Application:WB, Mouse, LβT2 cells.
-
Dual roles of myocardin-related transcription factors in epithelial mesenchymal transition via slug induction and actin remodeling.
Morita T, Mayanagi T, Sobue K.
Journal of Cellular Biology 2007 Dec; 179(5):1027.
Application:WB, Human, HepG2 cells.
-
Dysregulation of the TGFBI gene is involved in the oncogenic activity of the nonsense mutation of hepatitis B virus surface gene sW182*.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com