FN1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FN1 protein.
Immunogen
FN1 (AAH05858, 1 a.a. ~ 163 a.a) full-length human protein.
Sequence
MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FN1 MaxPab polyclonal antibody. Western Blot analysis of FN1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of FN1 expression in transfected 293T cell line (H00002335-T01) by FN1 MaxPab polyclonal antibody.
Lane 1: FN1 transfected lysate(23.21 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HGF and FN1. HeLa cells were stained with anti-HGF rabbit purified polyclonal 1:1200 and anti-FN1 mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FN1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FN1
Entrez GeneID
2335GeneBank Accession#
BC005858Protein Accession#
AAH05858Gene Name
FN1
Gene Alias
CIG, DKFZp686F10164, DKFZp686H0342, DKFZp686I1370, DKFZp686O13149, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF
Gene Description
fibronectin 1
Omim ID
135600Gene Ontology
HyperlinkGene Summary
This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
cold-insoluble globulin|migration-stimulating factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com