ERCC2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ERCC2 full-length ORF ( AAH08346, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
70.29
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ERCC2
Entrez GeneID
2068GeneBank Accession#
BC008346Protein Accession#
AAH08346Gene Name
ERCC2
Gene Alias
COFS2, EM9, MGC102762, MGC126218, MGC126219, TTD, XPD
Gene Description
excision repair cross-complementing rodent repair deficiency, complementation group 2
Gene Ontology
HyperlinkGene Summary
The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
excision repair cross-complementing rodent repair deficiency, complementation group 2 protein|xeroderma pigmentosum complementary group D
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Cadmium inhibits non-homologous end-joining and over-activates the MRE11-dependent repair pathway.
Viau M, Gastaldo J, Bencokova Z, Joubert A, Foray N.
Mutation Research 2008 May; 654(1):13.
Application:Enzyme, Helicase substrate.
-
Cadmium inhibits non-homologous end-joining and over-activates the MRE11-dependent repair pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com