MAPK14 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00001432-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

MAPK14 MaxPab rabbit polyclonal antibody. Western Blot analysis of MAPK14 expression in human placenta.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of MAPK14 expression in transfected 293T cell line (H00001432-T02) by MAPK14 MaxPab polyclonal antibody.

Lane 1: MAPK14 transfected lysate(41.30 KDa).
Lane 2: Non-transfected lysate.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between MAPK14 and EGFR. HeLa cells were stained with anti-MAPK14 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human MAPK14 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    MAPK14 (NP_620581.1, 1 a.a. ~ 360 a.a) full-length human protein.

    Sequence

    MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

    Host

    Rabbit

    Reactivity

    Human

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    MAPK14 MaxPab rabbit polyclonal antibody. Western Blot analysis of MAPK14 expression in human placenta.

    Western Blot (Transfected lysate)

    Western Blot analysis of MAPK14 expression in transfected 293T cell line (H00001432-T02) by MAPK14 MaxPab polyclonal antibody.

    Lane 1: MAPK14 transfected lysate(41.30 KDa).
    Lane 2: Non-transfected lysate.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between MAPK14 and EGFR. HeLa cells were stained with anti-MAPK14 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — MAPK14

    Entrez GeneID

    1432

    GeneBank Accession#

    NM_139012

    Protein Accession#

    NP_620581.1

    Gene Name

    MAPK14

    Gene Alias

    CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA

    Gene Description

    mitogen-activated protein kinase 14

    Omim ID

    600289

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

    Other Designations

    Csaids binding protein|MAP kinase Mxi2|MAX-interacting protein 2|cytokine suppressive anti-inflammatory drug binding protein|p38 MAP kinase|p38 mitogen activated protein kinase|p38alpha Exip|stress-activated protein kinase 2A

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All