ASCL1 monoclonal antibody (M02), clone 2D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ASCL1.
Immunogen
ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ASCL1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ASCL1
Entrez GeneID
429GeneBank Accession#
NM_004316Protein Accession#
NP_004307Gene Name
ASCL1
Gene Alias
ASH1, HASH1, MASH1, bHLHa46
Gene Description
achaete-scute complex homolog 1 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq
Other Designations
achaete scute protein|achaete-scute complex homolog 1|achaete-scute complex-like 1
-
Interactome
-
Disease
-
Publication Reference
-
Intrinsic and acquired drug resistance to LSD1 inhibitors in small cell lung cancer occurs through a TEAD4-driven transcriptional state.
Wen Yan, Chi-Yeh Chung, Tao Xie, Mark Ozeck, Timothy C Nichols, Jessica Frey, Akshata R Udyavar, Shikhar Sharma, Thomas A Paul.
Molecular Oncology 2022 Mar; 16(6):1309.
Application:WB-Ce, Human, COR-L88, DMS-114, H69, H82, H209, H446, H526, H889 cells.
-
Single-cell analysis reveals dynamic changes of neural cells in developing human spinal cord.
Qi Zhang, Xianming Wu, Yongheng Fan, Peipei Jiang, Yannan Zhao, Yaming Yang, Sufang Han, Bai Xu, Bing Chen, Jin Han, Minghan Sun, Guangfeng Zhao, Zhifeng Xiao, Yali Hu, Jianwu Dai.
EMBO reports 2021 Nov; 22(11):e52728.
Application:IF, IHC-Fr, Human, Human spinal cord sections.
-
Genetic and Immunohistochemical Studies Investigating the Histogenesis of Neuroendocrine and Carcinomatous Components of Combined Neuroendocrine Carcinoma.
Iijima M, Yokobori T, Mogi A, Shimizu K, Yajima T, Kosaka T, Ohtaki Y, Obayashi K, Nakazawa S, Gombodorj N, Tsukagoshi M, Shirabe K, Kuwano H.
Annals of Surgical Oncology 2019 Jun; 26(6):1744.
Application:IHC-P, Human, Human neuroendocrine carcinomas.
-
Intrinsic and acquired drug resistance to LSD1 inhibitors in small cell lung cancer occurs through a TEAD4-driven transcriptional state.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com