GSC monoclonal antibody (M03), clone 3D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GSC.
Immunogen
GSC (NP_776248, 151 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GSC monoclonal antibody (M03), clone 3D11. Western Blot analysis of GSC expression in SJCRH30 ( Cat # L027V1 ).Western Blot (Cell lysate)
GSC monoclonal antibody (M03), clone 3D11 Western Blot analysis of GSC expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M03), clone 3D11.
Lane 1: GSC transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSC is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GSC over-expressed 293 cell line, cotransfected with GSC Validated Chimera RNAi ( Cat # H00145258-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GSC monoclonal antibody (M03), clone 3D11 (Cat # H00145258-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — GSC
Entrez GeneID
145258GeneBank Accession#
NM_173849Protein Accession#
NP_776248Gene Name
GSC
Gene Alias
-
Gene Description
goosecoid homeobox
Omim ID
138890Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. [provided by RefSeq
Other Designations
goosecoid
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com