Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

GSC monoclonal antibody (M01), clone 4H7

  • Catalog # : H00145258-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GSC.
  • Immunogen:
  • GSC (NP_776248, 151 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00145258-M01
    Western Blot detection against Immunogen (37.51 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 1.
  • Generation of pluripotent stem cells from adult human testis.
    Conrad S, Renninger M, Hennenlotter J, Wiesner T, Just L, Bonin M, Aicher W, Buhring HJ, Mattheus U, Mack A, Wagner HJ, Minger S, Matzkies M, Reppel M, Hescheler J, Sievert KD, Stenzl A, Skutella T.Nature. 2008 Nov 20;456(7220):344-9. Epub 2008 Oct 8.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M01), clone 4H7.

    Lane 1: GSC transfected lysate(28.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSC MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged GSC is approximately 0.1ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • GSC
  • Gene Alias:
  • -
  • Gene Description:
  • goosecoid homeobox
  • Gene Summary:
  • This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. [provided by RefSeq
  • Other Designations:
  • goosecoid
  • RSS
  • YouTube
  • Linkedin
  • Facebook