GSC monoclonal antibody (M01), clone 4H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M01), clone 4H7.
Lane 1: GSC transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSC MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSC is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.51 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GSC.
Immunogen
GSC (NP_776248, 151 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M01), clone 4H7.
Lane 1: GSC transfected lysate(28.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSC MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GSC is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — GSC
Entrez GeneID
145258GeneBank Accession#
NM_173849Protein Accession#
NP_776248Gene Name
GSC
Gene Alias
-
Gene Description
goosecoid homeobox
Omim ID
138890Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. [provided by RefSeq
Other Designations
goosecoid
-
Interactome
-
Disease
-
Publication Reference
-
Generation of pluripotent stem cells from adult human testis.
Conrad S, Renninger M, Hennenlotter J, Wiesner T, Just L, Bonin M, Aicher W, Buhring HJ, Mattheus U, Mack A, Wagner HJ, Minger S, Matzkies M, Reppel M, Hescheler J, Sievert KD, Stenzl A, Skutella T.
Nature 2008 Oct; 456(7220):344.
Application：WB, Human, Human testicular parenchymas.
-
Generation of pluripotent stem cells from adult human testis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com