Product Browser

Last updated: 2014/4/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

TNFRSF19 monoclonal antibody (M01A), clone 2G4

  • Catalog # : H00055504-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF19.
  • Immunogen:
  • TNFRSF19 (AAH47321.1, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055504-M01A
    Western Blot detection against Immunogen (35.64 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TNFRSF19 monoclonal antibody (M01A), clone 2G4 Western Blot analysis of TNFRSF19 expression in HepG2 ( Cat # L019V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TNFRSF19 expression in transfected 293T cell line by TNFRSF19 monoclonal antibody (M01A), clone 2G4.

    Lane 1: TNFRSF19 transfected lysate(45.3 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TNFRSF19
  • Gene Alias:
  • TAJ,TAJ-alpha,TRADE,TROY
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 19
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018113,OTTHUMP00000018114,toxicity and JNK inducer
  • RSS
  • YouTube
  • Linkedin
  • Facebook