Product Browser

Last updated: 2014/4/21
  • Related Product Showcase
  • By Research Area

  • By Biomarker

  • By Antibody/Protein

  • By Application

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

SOHLH2 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00054937-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SOHLH2 protein.
  • Immunogen:
  • SOHLH2 (AAH25383.1, 1 a.a. ~ 225 a.a) full-length human protein.
  • Sequence:
  • MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SOHLH2 MaxPab rabbit polyclonal antibody. Western Blot analysis of SOHLH2 expression in human liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SOHLH2 expression in transfected 293T cell line (H00054937-T01) by SOHLH2 MaxPab polyclonal antibody.

    Lane 1: SOHLH2 transfected lysate(25.10 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SOHLH2 transfected lysate using anti-SOHLH2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TEB1 purified MaxPab mouse polyclonal antibody (B01P) (H00054937-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • SOHLH2
  • Gene Alias:
  • FLJ20449,TEB1,bA121N13.2
  • Gene Description:
  • spermatogenesis and oogenesis specific basic helix-loop-helix 2
  • Other Designations:
  • OTTHUMP00000018247
  • RSS
  • YouTube
  • Linkedin
  • Facebook