SOX30 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SOX30 partial ORF ( NP_848511, 644 a.a. - 753 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (75)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SOX30
Entrez GeneID
11063GeneBank Accession#
NM_178424Protein Accession#
NP_848511Gene Name
SOX30
Gene Alias
-
Gene Description
SRY (sex determining region Y)-box 30
Omim ID
606698Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
Sox30 protein type II
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com