GNB5 monoclonal antibody (M01), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GNB5.
Immunogen
GNB5 (NP_057278, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEAL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody (M01), clone 3A3.
Lane 1: GNB5 transfected lysate(38.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GNB5 is 0.1 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — GNB5
Entrez GeneID
10681GeneBank Accession#
NM_016194Protein Accession#
NP_057278Gene Name
GNB5
Gene Alias
FLJ37457, FLJ43714, GB5
Gene Description
guanine nucleotide binding protein (G protein), beta 5
Omim ID
604447Gene Ontology
HyperlinkGene Summary
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq
Other Designations
G protein, beta subunit 5L|G protein, beta-5 subunit|guanine nucleotide-binding protein, beta subunit 5L|guanine nucleotide-binding protein, beta-5 subunit|transducin beta chain 5
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com