CUGBP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CUGBP1 full-length ORF ( NP_941989.1, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
78
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CUGBP1
Entrez GeneID
10658GeneBank Accession#
NM_198700.1Protein Accession#
NP_941989.1Gene Name
CUGBP1
Gene Alias
BRUNOL2, CUG-BP, CUGBP, NAB50, hNab50
Gene Description
CUG triplet repeat, RNA binding protein 1
Omim ID
601074Gene Ontology
HyperlinkGene Summary
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CUG RNA-binding protein|CUG triplet repeat, RNA-binding protein 1|bruno-like 2|nuclear polyadenylated RNA-binding protein, 50-kD
-
Interactome
-
Publication Reference
-
Splice-switching of the insulin receptor pre-mRNA alleviates tumorigenic hallmarks in rhabdomyosarcoma.
Safiya Khurshid, Matias Montes, Daniel F Comiskey Jr, Brianne Shane, Eleftheria Matsa, Francesca Jung, Chelsea Brown, Hemant Kumar Bid, Ruoning Wang.
NPJ Precision Oncology 2022 Jan; 6(1):1.
Application：GSA, N/A, RNA probe.
-
miR-574-5p as RNA decoy for CUGBP1 stimulates human lung tumor growth by mPGES-1 induction.
Saul MJ, Baumann I, Bruno A, Emmerich AC, Wellstein J, Ottinger SM, Contursi A, Dovizio M, Donnini S, Tacconelli S, Raouf J, Idborg H, Stein S, Korotkova M, Savai R, Terzuoli E, Sala G, Seeger W, Jakobsson PJ, Patrignani P, Suess B, Steinhilber D.
FASEB Journal 2019 Jun; 33(6):6933.
Application：Func, Human, A-549 cells.
-
Competitive binding of CUGBP1 and HuR to occludin mRNA controls its translation and modulates epithelial barrier function.
Yu TX, Rao JN, Zou T, Liu L, Xiao L, Ouyang M, Cao S, Gorospe M, Wang JY.
Molecular Biology of the Cell 2013 Jan; 24(2):85.
Application：WB, Human, Caco-2 cells.
-
Splice-switching of the insulin receptor pre-mRNA alleviates tumorigenic hallmarks in rhabdomyosarcoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com