Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

ADIPOQ polyclonal antibody (A01)

  • Catalog # : H00009370-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ADIPOQ.
  • Immunogen:
  • ADIPOQ (NP_004788, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009370-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9370
  • Gene Name:
  • ADIPOQ
  • Gene Alias:
  • ACDC,ACRP30,ADPN,APM-1,APM1,GBP28,adiponectin
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Gene Summary:
  • This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
  • Other Designations:
  • adipocyte, C1Q and collagen domain containing,adipocyte, C1Q and collagen domain-containing,adiponectin,adipose most abundant gene transcript 1,gelatin-binding protein 28
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook