Product Browser

Last updated: 2014/4/14
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

VAPB purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00009217-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human VAPB protein.
  • Immunogen:
  • VAPB (NP_004729.1, 1 a.a. ~ 243 a.a) full-length human protein.
  • Sequence:
  • MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • VAPB MaxPab polyclonal antibody. Western Blot analysis of VAPB expression in human placenta.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • VAPB MaxPab polyclonal antibody. Western Blot analysis of VAPB expression in HeLa.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of VAPB expression in transfected 293T cell line (H00009217-T02) by VAPB MaxPab polyclonal antibody.

    Lane 1: VAPB transfected lysate(26.73 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 9217
  • Gene Name:
  • VAPB
  • Gene Alias:
  • ALS8,VAMP-B,VAMP-C,VAP-B,VAP-C
  • Gene Description:
  • VAMP (vesicle-associated membrane protein)-associated protein B and C
  • Gene Summary:
  • The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031393,VAMP-associated 33 kDa protein,VAMP-associated protein B,VAMP-associated protein B/C,VAMP-associated protein C
  • RSS
  • YouTube
  • Linkedin
  • Facebook